Update
Tags:
Search: englandwnt Β» Page 8
203 stories
Like No Other Girl
While being on set on his superhero series, he met a well known celebrity who's also known on another superhero movie. His only main focus is his education and Tv series but that doesn't stop him falling in love with her, she was like no other girl he had ever met. Find out more;)
Magic Like Good And Evil (a Narnia Fanfic)
"ππ’π₯πͺπ΄ πΈπ’π΄π―'π΅ π―πͺπ€π¦ π΅π° ππ’πΊπ»π’π΅πΊπ, π£πΆπ΅ π¦π·π¦π― π΄π° π΄π©π¦ ππ°π·π¦π₯ π©π¦π΅ π΄πͺπ΄π΅π¦π³ πͺπ― π’π―πΊπΈπ’πΊ π±π°π΄π΄πͺπ£ππ¦."----Narnia fanfic about the older sister of the White Wich Jadis.Starts in The Magician's Nephew-----Jadis isn't the only wich in her family, her older sister Mayazatyl could easely outmatch her. And that is something that shouldn't happen.But Maya won't go down without a fight, and sometimes you only need a little help to go all the way.----
πππ«ππ§ππ’π©π’ππ² | Joel Miller - ππππ π ππ§ππ’πππ’π¨π§
Lilly has been on her own ever since she lost her brother. Surviving in the outskirts of Wyoming, she constantly managed to outrun infected and hunters. However, her streak of luck took a downturn when she encountered a trio of armed individuals, as their initial interaction laid the groundwork for a strained and unfavorable relationship.Will she be able steer things in the right direction?
I think I May Have S.F.D and S.B.D
This is a warning of what it is like to be band whore and/ or a fandom. Some readers may find these details disturbing or may be able to relate to these events so I advise you to please proceed with caution.
PURELY RANTING RANDOMNESS DIARY
Aren't made for children, you know?My rants listed in order of days, and my touch of life in it. Where I'm not a writer, but a ranter.WHERE ALL MY THOUGHTS ARE TAKEN PLACE.
Pyromancy Ladies
Pyromancy Ladies is a fictional story that based on Horoscopes. A dozen of ladies with power and beauty that lived in the estate, trying to solve the cursed. "You will know what's your purpose in this world"What's your horoscope? Are you one of the leading lady in my story?
Pitstop
Inconspicuous yet not exactly imperceptible is the cafe Pitstop. Located in downtown Toronto, it stands silently sandwiched in between two buildings.Hana is a girl who's looking for a job and Pitstop seems to be the perfect setting: it's quiet, there's not a constant overflow of customers, and of course there's the free discounts. What else can a girl ask for?Except, she might have asked a bit too much.Too much to the point that the gods have decided to send her the devil's spawn; Hale. She meets Hale and he's frustrating, hockey obsessed, immature, in love with the band Galactrixs, and a tad too arrogant. Which is basically most of the things, Hana dislikes.
"ππΈπΌπ½ π£ππ²π·πΌ"
π―ππππ π΄π π«ππππππ'π! π° ππππ π ππππππππππππ πππ ππππ πππ ππ ππππ πππππππ ππππ πππ ππ πππππππ! π»πππ ππ πππ ππππππ π ππππππππ πππ ππππ. π»ππ π©πππ πͺππππ ππ ππππ, ππ ππππ'π πππππππ πππππ πππ πππππππ ππ ππ πππππππππ πππ'π ππππ ππππππππ. π° πππππ πππππ ππ ππππ πππ πππππππ ππ ππππ πππππ ππππ ππππππ! π―πππ πππ πππ πππππ πππππ ππππ πππππ.πΉπΉππππ πππ π΄πππ πππππππΉβοΈπ΅π πΊπππ πππππππ π πππππ πππ ππππππ π ππππ πππ ππππ "π©ππππ πππ"βοΈ.βοΈπ½πππ πΊπππππ π³πππππππ πππππππ π ππππ ππ πβοΈ.βοΈπ° πππππππ π ππ π'π ππππ π πΎππππππΉπππ ππ πππππ π€ ππππ ππ πππ ππππ πππ:https://www.wattpad.com/1360364537?utm_source=android&utm_medium=link&utm_content=share_published&wp_page=create_on_publish&wp_uname=Blood1Lunarismylife&wp_originator=dwNTg1hzBxTp6pvXlbMPkeyg9zyXLTPmP9as3MkxvaLQpIUV%2BiK
Chasing Americans.
"Bruce get your sorry butt down here." "What did I do now?" "Would you like to tell me why my car has your and all your friend's names on its boot in bright pink paint?"Okay Colette isn't quite your average girl. She moved from London to LA to start fresh. No relationships, no school, no mother and surely no snobby rich kids of Downton Abby. Or so she thought. She was thrown into the lifestyle, that belonged to the rich and famous. Sport cars to fancy gourmet breakfasts. Join this odd character on the journey where she will find herself aswell as the car keys she missplaced this morning. And what with happen when a British girl fell for a famous American? Find out in this hell of a book.---Started in 2017.
5 TRAVEL TIPS TO BELGIUM
<strong>Food -</strong> buying food at the cafes and eateries is around 15 EUR. A meal in a sit-down restaurant with a drink is about 35 EUR. Frites (French fries), which is remarkably popular in the country, costs around 5 EUR. If you want to prepare your meals, there are some good markets throughout the city. Expect to pay around 50-70 EUR for a week's worth of markets. The panel is a national chain serving cheap and tasty sandwiches.<strong>Transportation-</strong> Downtown Metro tickets are approximately 4-8 EUR per tour. Driving around the country is not that too expensive as the country is small and easy to move around. Most city train tickets cost around 20 EUR for a second class ticket. <a href="https://www.streetviewmaps.city/brussels-belgium/">Brussels</a> to Bruges by train costs 10-15 EUR. Brussels to Antwerp by train costs 5-9 EUR. Intercity bus tickets are not costly, usually 17 EUR for most trips. Getting to and from most of the primary airports is quite simple, with buses and trains readily available it cost about 15 EUR (usually less) for a one-way ticket.<strong>Social laws:</strong> Knowing which language to speak where can be complicated. Avoid speaking Dutch in Wallonia and French in Flanders. Most locals are laid back, but it can cause offense if you get it wrong in some groups. If in doubt, speak English.Outside of business activities, it's conventional to kiss three times on temporary cheeks. Guests should visit come along flowers, or a little gift, for the owner if they're requested for a meal, and it is a regular to wish everyone on appetite/get snakelike at the start of a meal. The dress is similar to other Western nations: jeans and a smart top suffice for most occasions, comprising of nights outing. It is a great offense if you smoke in the venue where food is served.
Jily: A Two Sided Story
(In progress)Same story. Different sides. One thinks one thing, the other...another. James and Lily. Lily and James. Will they ever feel the same way as each other at the same time? Will it be a constant nightmare or a match made in heaven? Let's see...Please comment and give prompts :)(All characters belong to J.K Rowling unless stated otherwise) (All art is distributed through Google)
OneHost Software Review - Unlimited Website and Domain Hosting
OneHost introduces its latest hosting solution, the Titanium Core Technology unlimited one-time hosting product. This technology offers lightning-fast website speeds and unparalleled performance, ideal for businesses and individuals seeking top-notch hosting.With a solid-state drive (SSD) server, you'll experience faster loading times, improved performance, and reduced downtime. The package includes unlimited storage and bandwidth, along with an easy-to-use control panel.OneHost ensures high security with 24/7 server monitoring and daily data backups. Plus, their customer support team is available 24/7 via live chat, email, and phone. Experience the power of OneHost's Titanium Core Technology today.
Paradoxical
Alaska Oakley was a second year student when Harry Potter first came to Hogwarts, born in America from a long line of pureblood's she -almost- fit right in at the Slytherin table. That is until she befriended a curly haired Gryffindor named Savannah Lanton. The duo causing mayhem and stirring up trouble regardless of house rivalry- which neither of them paid much mind too. As their second year rolls around and the 'boy who lived' arrives at Hogwarts the two girls are in for a much more eventful year.- Slight Language warning- The first year will move along quite fast- as Alaska and Savannah are not going to be apart of every little thing the Golden Trio is. This book is a work in progress so updates may or not be frequent and there may (most likely will be) errors now and then.[ Book one --- Undecided ](c) I do not own or claim rights to the world of Harry Potter or the characters in it. I do not claim ownership of any direct quotes taken from the books / movies. I only claim ownership of Alaska and other original characters mentioned in this story. Savannah is owned by my best friend who I thank with all my heart for contributing to this story with me.
Azure Migration Services
There are several Azure Migration Services available, including:Azure Migrate: A central hub for assessment and migration of on-premises servers, virtual machines, databases, and web applications to Azure. It provides a comprehensive overview of the migration process and helps organizations identify the right migration path for their workloads.Azure Site Recovery: A disaster recovery solution that replicates workloads running on physical or virtual machines from a primary site to a secondary site in Azure. It can be used for both planned and unplanned failover scenarios.Azure Database Migration Service: A fully-managed service that helps organizations migrate their databases to Azure with minimal downtime. It supports a variety of database sources, including SQL Server, Oracle, MySQL, and PostgreSQL.Azure Data Box: A physical device that organizations can use to transfer large amounts of data to Azure. It is particularly useful for organizations with limited internet bandwidth or with data that cannot be easily transferred over the internet.Azure App Service Migration Assistant: A tool that helps organizations migrate their web applications to Azure App Service. It supports a variety of web frameworks and languages, including .NET, Java, PHP, and Node.js.
~ All witches are red ~
Three truths that every modern girl knows: magic does not exist, witches were exterminated in the Middle Ages, Koschey died from a needle that was in an egg, which was in a duck, which... How could it not be so! One has only to take a closer look, and it turns out that your persistent admirer is a sorcerer and is slipping you not juice, but the most literal love potion, your favorite coach seems to be a magician, and the hero and pipe dream of the entire university is in fact the grandson of a still living Koshcheya. Fairy tale? Maybe. But in this fairy tale, the evil is somehow too arrogant, and the good is downtrodden and hiding in the swamps for its own survival. So what should Ritka do? Become a witch! And definitely red-haired, harmful and malicious. Then take the broom in your hands and rush... to restore order. And remember - good will certainly defeat evil! Definitely... So that it is discouraging! By the way, do you know what kind red-haired witches turn into?Original language: RussianAuthor: Elena ZvezdnayaTranslation: Elyzaveta Galimska
Why Government jobs are important
Government Jobs or Sarkari Naukri, In the current setting that everybody on the planet hurry to find an administration line of work. The elements of the government is the most requesting work in the adolescent segment of the present age, particularly on account of the security and advantages gave by the legislature of the staff. After the downturn that hit the world in 2008 individuals are progressively stressed over professional stability and what's to come. The elements of the government to pay incredibly, great. A large number of job vacancy in government sector like- bank jobs, railways jobs and the data innovation, broadcast communications and focal government, state and Central government- SSC, UPSC, schools, colleges, carriers, air terminals and different regions too, however there isn't a lot simpler to land government positions. Nowadays there are online forms for taking government exams. It takes a great deal of groundwork for the composed test and meeting at once. When you find a new line of work, at that point your life will be extremely smooth since it gives venture out recompenses and training to youngsters, maturing, and guarantees that. Advantages of government workers. The end result of the government jobs is very fruitful for everyone. Although, initially it requires lots of efforts to crack government exams.All the best!
The Fairy Squad Princesses: Battle for the Future (Book 3)
Once again, after another enduring battle against the Dark Warriors, the Light Guardians were finally able to rest before heading into their third year of magic school. WRONG! Instead of relaxing during their summer vacation, a floating castle made of ice appeared out of nowhere in the sky of Downtown Los Angeles.Melisma ends up having to put her studio time with her father on the back burner and alert her besties. To no surprise, the Vortex and the nitwits are a part of the disturbance. Not only have the adversaries returned, but they look different.The longtime enemies have teamed up with some new enemies who claim they're from the future! Will Serena, Max, and their friends be able to triumph over evil again? Or will darkness finally prevail?https://www.amazon.com/dp/1978149484/ref=sr_1_1?dchild=1&qid=1605819071
a safe place
everyoneissohappytodaylotsofsmilinghowjoyoushowjoyousverysaferightiknowwewillbehappyherelookathowgladtheylooksoveryhappydoyouwanttobehappyiknowidohappyandsafeverysafeilikebeingsafedoyouwanttobesafeeveryonedoesandeveryonewantstosmileandbehappyveryhappyjustlotsofjoyasbrightasthesunnobodycanhurtyoueveragainareyousmilingnowihopeyouarebecauseimsohappyveryhappysohappythaticanmakesomethingsoamazingdoyouwanttohearsomethingamazingiknowyoudoucanmakeamazingthingstheyarehappyeveryonewantshappyfamilylikeshappywholeworldlikeshappyilikehappyyoulikehappywelikehappytheylikehappysoletsallholdhandsandbehappytogetherasishowmynicethingsverynicethingstheyareaslovelyasherhairandwejoyouslycontinueoneyesshiftingfromonewordtothenextbeinghappyjusthappyreadingisnicerightyoulikereadingreadingishappyiamhappymyfingerspluckthestringsofitsohappilytheyaresorebutiamhappyiamblessedeveryoneishereformenobodyhasleftmeifeelliketheworldhasspoiledmewithsuchhappinessjustsmilesiamsohappyhappyisgoodmusicishappyimakemusiclovelyhappymusiciamverytalenterbecauseofhappyyouaregoodbecauseofhappytoosoweneedmorehappysojustsmilebehappyweneedhappymorehappysowecanallsmilejustlikethesparkofpurejoyjoyouslyfrolickinginafieldofhappyhandsdrenchedinhappyaswegripthehappyinourhandsweraisehappyandplungehappyintohappyhappylaughingsmilingjoyhappythehappysetsdownthehappyasthehappycoverstheshininghappyintheskythewholeworldsmileswearejusthappy
Take Advantage of The Anointing
By Pastor ChrisBut the anointing which ye have received of him abideth in you...(1 John 2:27).Being born again, the anointing of the Holy Spirit is on your life. That anointing makes your life supernatural! You're different from the rest of the world. Your words have power, because you're an associate of the God-kind.When Moses stood before the Red Sea and God said to him, "Moses, stretch your hand over the water and divide it," he obeyed God and stretched his hand over the water. At that moment, he ceased to be the mere man, Moses; he was in union with divinity. Why? Because when he stretched forth his hand, the hand of God was stretched forth also. When he spoke words, they weren't the words of Moses but the words of God, for his words became anointed by the Holy Spirit.The anointing of the Holy Spirit is for you, and in you, if you're born again. If you've received the Holy Ghost, that anointing of God's Spirit will come upon everything that you do. This is what it means to be blessed; the anointing is deposited on everything you touch. That anointing leads and guides you. That anointing makes you a success, irrespective of the happenings in the world.The economy of this world was designed to fail, for it's headed in the structure of fallen man. So when you hear of economic downturns, don't fear. The anointing sets you apart! Go higher, by applying spiritual principles through the power of the Holy Spirit.Never lose the consciousness of the anointing in your life. It's for your advantage. Therefore, use it for your health, academics, family, job, finances, and every area of your life. I'm not talking of some oil in a bottle or a piece of cloth from a preacher. I'm talking of the real person of the Holy Spirit, and your consciousness of His indwelling and abiding presence!CONFESSIONI have an unction from the Holy One! That anointing is working in my body, finances, family, and all that concerns me. When men are cast down, I'm lifted! Blessed be God!